Protein Info for b2945 in Escherichia coli BW25113

Name: endA
Annotation: DNA-specific endonuclease I (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF04231: Endonuclease_1" amino acids 42 to 229 (188 residues), 168.6 bits, see alignment E=9.6e-54

Best Hits

Swiss-Prot: 100% identical to END1_ECOLI: Endonuclease-1 (endA) from Escherichia coli (strain K12)

KEGG orthology group: K01150, deoxyribonuclease I [EC: 3.1.21.1] (inferred from 100% identity to eco:b2945)

MetaCyc: 100% identical to DNA-specific endonuclease I (Escherichia coli K-12 substr. MG1655)
Deoxyribonuclease I. [EC: 3.1.21.1]

Predicted SEED Role

"Endonuclease I precursor (EC 3.1.21.1) @ Extracellular deoxyribonuclease Dns (EC 3.1.21.-)" (EC 3.1.21.-, EC 3.1.21.1)

Isozymes

Compare fitness of predicted isozymes for: 3.1.21.-

Use Curated BLAST to search for 3.1.21.- or 3.1.21.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P25736 at UniProt or InterPro

Protein Sequence (235 amino acids)

>b2945 DNA-specific endonuclease I (NCBI) (Escherichia coli BW25113)
MYRYLSIAAVVLSAAFSGPALAEGINSFSQAKAAAVKVHADAPGTFYCGCKINWQGKKGV
VDLQSCGYQVRKNENRASRVEWEHVVPAWQFGHQRQCWQDGGRKNCAKDPVYRKMESDMH
NLQPSVGEVNGDRGNFMYSQWNGGEGQYGQCAMKVDFKEKAAEPPARARGAIARTYFYMR
DQYNLTLSRQQTQLFNAWNKMYPVTDWECERDERIAKVQGNHNPYVQRACQARKS