Protein Info for b2944 in Escherichia coli BW25113

Name: sprT
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 165 PF10263: SprT-like" amino acids 19 to 115 (97 residues), 81.8 bits, see alignment E=3.2e-27 PF17283: Zn_ribbon_SprT" amino acids 126 to 164 (39 residues), 34.2 bits, see alignment 2.2e-12

Best Hits

Swiss-Prot: 100% identical to SPRT_ECOHS: Protein SprT (sprT) from Escherichia coli O9:H4 (strain HS)

KEGG orthology group: K02742, SprT protein (inferred from 100% identity to eco:b2944)

Predicted SEED Role

"Protein sprT"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P39902 at UniProt or InterPro

Protein Sequence (165 amino acids)

>b2944 hypothetical protein (NCBI) (Escherichia coli BW25113)
MKTSRLPIAIQQAVMRRLREKLAQANLKLGRNYPEPKLSYTQRGTSAGTAWLESYEIRLN
PVLLLENSEAFIEEVVPHELAHLLVWKHFGRVAPHGKEWKWMMENVLGVPARRTHQFELQ
SVRRNTFPYRCKCQEHQLTVRRHNRVVRGEAVYRCVHCGEQLVAK