Protein Info for b2942 in Escherichia coli BW25113

Name: metK
Annotation: S-adenosylmethionine synthetase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00438: S-AdoMet_synt_N
  • amino acids 4 to 101 (98 residues), 150.9 bits, E=2e-48
• TIGR01034: methionine adenosyltransferase
  • amino acids 5 to 380 (376 residues), 667.2 bits, E=3.4e-205
• PF02772: S-AdoMet_synt_M
  • amino acids 114 to 231 (118 residues), 167.1 bits, E=2.6e-53
• PF02773: S-AdoMet_synt_C
  • amino acids 233 to 370 (138 residues), 235.3 bits, E=2.8e-74

Best Hits

Swiss-Prot: 100% identical to METK_SHIDS: S-adenosylmethionine synthase (metK) from Shigella dysenteriae serotype 1 (strain Sd197)

KEGG orthology group: K00789, S-adenosylmethionine synthetase [EC: 2.5.1.6] (inferred from 100% identity to eco:b2942)

MetaCyc: 100% identical to methionine adenosyltransferase (Escherichia coli K-12 substr. MG1655)
Methionine adenosyltransferase. [EC: 2.5.1.6]

Predicted SEED Role

"S-adenosylmethionine synthetase (EC 2.5.1.6)" in subsystem Methionine Biosynthesis or Methionine Degradation or Quorum Sensing: Autoinducer-2 Synthesis (EC 2.5.1.6)

MetaCyc Pathways

• aspartate superpathway (24/25 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (9/9 steps found)
• S-adenosyl-L-methionine salvage I (4/4 steps found)
• S-adenosyl-L-methionine biosynthesis (1/1 steps found)
• S-adenosyl-L-methionine salvage II (2/3 steps found)
• L-cysteine biosynthesis VI (reverse transsulfuration) (4/7 steps found)
• L-methionine degradation I (to L-homocysteine) (1/3 steps found)
• ethene biosynthesis I (plants) (1/3 steps found)
• 2'-deoxymugineic acid phytosiderophore biosynthesis (1/4 steps found)
• superpathway of L-cysteine biosynthesis (mammalian) (1/5 steps found)
• L-methionine salvage cycle III (5/11 steps found)
• L-methionine salvage cycle I (bacteria and plants) (5/12 steps found)
• L-methionine salvage cycle II (plants) (3/11 steps found)
• superpathway of L-methionine salvage and degradation (6/16 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Methionine metabolism
• Selenoamino acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.6

Sequence Analysis Tools

See P0A817 at UniProt or InterPro

Protein Sequence (384 amino acids)

>b2942 S-adenosylmethionine synthetase (NCBI) (Escherichia coli BW25113)
MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTS
AWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQ
GLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVG
IDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDC
GLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVS
YAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGH
FGREHFPWEKTDKAQLLRDAAGLK