Protein Info for b2937 in Escherichia coli BW25113

Name: speB
Annotation: agmatinase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01230: agmatinase
  • amino acids 22 to 299 (278 residues), 395.3 bits, E=8.6e-123
• PF00491: Arginase
  • amino acids 33 to 297 (265 residues), 303.7 bits, E=6.8e-95

Best Hits

Swiss-Prot: 100% identical to SPEB_SHIBS: Agmatinase (speB) from Shigella boydii serotype 4 (strain Sb227)

KEGG orthology group: K01480, agmatinase [EC: 3.5.3.11] (inferred from 100% identity to eco:b2937)

MetaCyc: 100% identical to agmatinase (Escherichia coli K-12 substr. MG1655)
Agmatinase. [EC: 3.5.3.11]

Predicted SEED Role

"Agmatinase (EC 3.5.3.11)" in subsystem Arginine and Ornithine Degradation or Polyamine Metabolism (EC 3.5.3.11)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (16/17 steps found)
• superpathway of L-arginine and L-ornithine degradation (13/13 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (11/11 steps found)
• superpathway of polyamine biosynthesis I (7/8 steps found)
• L-arginine degradation III (arginine decarboxylase/agmatinase pathway) (2/2 steps found)
• putrescine biosynthesis I (2/2 steps found)
• superpathway of putrescine biosynthesis (3/4 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.11

Sequence Analysis Tools

See P60651 at UniProt or InterPro

Protein Sequence (306 amino acids)

>b2937 agmatinase (NCBI) (Escherichia coli BW25113)
MSTLGHQYDNSLVSNAFGFLRLPMNFQPYDSDADWVITGVPFDMATSGRAGGRHGPAAIR
QVSTNLAWEHNRFPWNFDMRERLNVVDCGDLVYAFGDAREMSEKLQAHAEKLLAAGKRML
SFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCEFDHGTMFYTAPKEGLIDPNH
SVQIGIRTEFDKDNGFTVLDACQVNDRSVDDVIAQVKQIVGDMPVYLTFDIDCLDPAFAP
GTGTPVIGGLTSDRAIKLVRGLKDLNIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQ
AAKKGE