Protein Info for b2933 in Escherichia coli BW25113

Name: cmtA
Annotation: predicted fused mannitol-specific PTS enzymes: IIB component/IIC component (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 transmembrane" amino acids 12 to 40 (29 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 81 to 105 (25 residues), see Phobius details amino acids 134 to 158 (25 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details amino acids 247 to 266 (20 residues), see Phobius details amino acids 269 to 305 (37 residues), see Phobius details amino acids 313 to 335 (23 residues), see Phobius details TIGR00851: PTS system, mannitol-specific IIC component" amino acids 9 to 344 (336 residues), 479.7 bits, see alignment E=2.3e-148 PF02378: PTS_EIIC" amino acids 20 to 277 (258 residues), 99 bits, see alignment E=2.9e-32 PF02302: PTS_IIB" amino acids 372 to 454 (83 residues), 48.5 bits, see alignment E=1.1e-16

Best Hits

Swiss-Prot: 100% identical to PTMCB_ECO57: PTS system mannitol-specific cryptic EIICB component (cmtA) from Escherichia coli O157:H7

KEGG orthology group: K02799, PTS system, mannitol-specific IIB component [EC: 2.7.1.69] K02800, PTS system, mannitol-specific IIC component (inferred from 100% identity to eco:b2933)

MetaCyc: 100% identical to mannitol-specific PTS enzyme IICB component CmtA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-156 [EC: 2.7.1.197]

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.197, 2.7.1.69

Use Curated BLAST to search for 2.7.1.197 or 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P69826 at UniProt or InterPro

Protein Sequence (462 amino acids)

>b2933 predicted fused mannitol-specific PTS enzymes: IIB component/IIC component (NCBI) (Escherichia coli BW25113)
MENKSARAKVQAFGGFLTAMVIPNIGAFIAWGFITALFIPTGWLPNEHFAKIVGPMITYL
LPVMIGSTGGHLVGGKRGAVMGGIGTIGVIVGAEIPMFLGSMIMGPLGGLVIKYVDKALE
KRIPAGFEMVINNFSLGIAGMLLCLLGFEVIGPAVLIANTFVKECIEALVHAGYLPLLSV
INEPAKVLFLNNAIDQGVYYPLGMQQASVNGKSIFFMVASNPGPGLGLLLAFTLFGKGMS
KRSAPGAMIIHFLGGIHELYFPYVLMKPLTIIAMIAGGMSGTWMFNLLDGGLVAGPSPGS
IFAYLALTPKGSFLATIAGVTVGTLVSFAITSLILKMEKTVETESEDEFAQSANAVKAMK
QEGAFSLSRVKRIAFVCDAGMGSSAMGATTFRKRLEKAGLAIEVKHYAIENVPADADIVV
THASLEGRVKRVTDKPLILINNYIGDPKLDTLFNQLTAEHKH