Protein Info for b2929 in Escherichia coli BW25113
Name: yggD
Annotation: predicted DNA-binding transcriptional regulator (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to FUME_ECOLI: Fumarase E (fumE) from Escherichia coli (strain K12)
KEGG orthology group: None (inferred from 100% identity to eco:b2929)MetaCyc: 100% identical to fumarase E (Escherichia coli K-12 substr. MG1655)
Fumarate hydratase. [EC: 4.2.1.2]
Predicted SEED Role
"Putative transcriptional regulator"
MetaCyc Pathways
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (25/26 steps found)
- mixed acid fermentation (16/16 steps found)
- superpathway of glyoxylate bypass and TCA (11/12 steps found)
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (18/22 steps found)
- TCA cycle I (prokaryotic) (9/10 steps found)
- partial TCA cycle (obligate autotrophs) (7/8 steps found)
- superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
- TCA cycle III (animals) (8/10 steps found)
- TCA cycle VIII (Chlamydia) (5/6 steps found)
- (S)-lactate fermentation to propanoate, acetate and hydrogen (10/13 steps found)
- TCA cycle II (plants and fungi) (7/9 steps found)
- TCA cycle IV (2-oxoglutarate decarboxylase) (7/9 steps found)
- TCA cycle V (2-oxoglutarate synthase) (7/9 steps found)
- TCA cycle VI (Helicobacter) (7/9 steps found)
- reductive TCA cycle I (8/11 steps found)
- incomplete reductive TCA cycle (5/7 steps found)
- pyruvate fermentation to propanoate I (5/7 steps found)
- anaerobic energy metabolism (invertebrates, mitochondrial) (7/10 steps found)
- superpathway of anaerobic energy metabolism (invertebrates) (12/17 steps found)
- TCA cycle VII (acetate-producers) (6/9 steps found)
- reductive TCA cycle II (8/12 steps found)
- L-glutamate degradation VIII (to propanoate) (5/11 steps found)
- methylaspartate cycle (9/19 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (22/56 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Citrate cycle (TCA cycle)
- Reductive carboxylate cycle (CO2 fixation)
Isozymes
Compare fitness of predicted isozymes for: 4.2.1.2
Use Curated BLAST to search for 4.2.1.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P11663 at UniProt or InterPro
Protein Sequence (169 amino acids)
>b2929 predicted DNA-binding transcriptional regulator (NCBI) (Escherichia coli BW25113) MATLTEDDVLEQLDAQDNLFSFMKTAHTILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQ SGPLDDIDVALRLIYALGKMDKWLYADITHFSQFWHYLNEQDETPGFADDMTWDFISNVN SITRNAMLYDALKAMKFADFSVWSEARFSGMVKTALTLAVTTTLKELTP