Protein Info for b2919 in Escherichia coli BW25113

Name: ygfG
Annotation: putative enzyme (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF00378: ECH_1" amino acids 12 to 259 (248 residues), 160.3 bits, see alignment E=5.7e-51 PF16113: ECH_2" amino acids 15 to 195 (181 residues), 76.3 bits, see alignment E=3.2e-25

Best Hits

Swiss-Prot: 100% identical to SCPB_ECOLI: Methylmalonyl-CoA decarboxylase (scpB) from Escherichia coli (strain K12)

KEGG orthology group: K11264, methylmalonyl-CoA decarboxylase [EC: 4.1.1.41] (inferred from 100% identity to eco:b2919)

MetaCyc: 100% identical to methylmalonyl-CoA decarboxylase (Escherichia coli K-12 substr. MG1655)
4.1.1.M5 [EC: 4.1.1.M5]

Predicted SEED Role

"Methylmalonyl-CoA decarboxylase (EC 4.1.1.41)" (EC 4.1.1.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.41 or 4.1.1.M5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P52045 at UniProt or InterPro

Protein Sequence (261 amino acids)

>b2919 putative enzyme (VIMSS) (Escherichia coli BW25113)
MSYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNRPEIRCIILRAPSGSK
VFSAGHDIHELPSGGRDPLSYDDPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDL
IIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNH
VVEVEELEDFTLQMAHHISEKAPLAIAVIKEELRVLGEAHTMNSDEFERIQGMRRAVYDS
EDYQEGMNAFLEKRKPNFVGH