Protein Info for b2919 in Escherichia coli BW25113

Name: ygfG
Annotation: putative enzyme (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 12 to 259 (248 residues), 160.3 bits, E=5.7e-51
• PF16113: ECH_2
  • amino acids 15 to 195 (181 residues), 76.3 bits, E=3.2e-25

Best Hits

Swiss-Prot: 100% identical to SCPB_ECOLI: Methylmalonyl-CoA decarboxylase (scpB) from Escherichia coli (strain K12)

KEGG orthology group: K11264, methylmalonyl-CoA decarboxylase [EC: 4.1.1.41] (inferred from 100% identity to eco:b2919)

MetaCyc: 100% identical to methylmalonyl-CoA decarboxylase (Escherichia coli K-12 substr. MG1655)
4.1.1.M5 [EC: 4.1.1.M5]

Predicted SEED Role

"Methylmalonyl-CoA decarboxylase (EC 4.1.1.41)" (EC 4.1.1.41)

MetaCyc Pathways

• conversion of succinate to propanoate (3/3 steps found)

KEGG Metabolic Maps

• Propanoate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.41 or 4.1.1.M5

Sequence Analysis Tools

See P52045 at UniProt or InterPro

Protein Sequence (261 amino acids)

>b2919 putative enzyme (VIMSS) (Escherichia coli BW25113)
MSYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNRPEIRCIILRAPSGSK
VFSAGHDIHELPSGGRDPLSYDDPLRQITRMIQKFPKPIISMVEGSVWGGAFEMIMSSDL
IIAASTSTFSMTPVNLGVPYNLVGIHNLTRDAGFHIVKELIFTASPITAQRALAVGILNH
VVEVEELEDFTLQMAHHISEKAPLAIAVIKEELRVLGEAHTMNSDEFERIQGMRRAVYDS
EDYQEGMNAFLEKRKPNFVGH