Protein Info for b2883 in Escherichia coli BW25113

Name: guaD
Annotation: guanine deaminase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02967: guanine deaminase
  • amino acids 33 to 432 (400 residues), 633.5 bits, E=7.6e-195
• PF01979: Amidohydro_1
  • amino acids 74 to 435 (362 residues), 268.3 bits, E=1.1e-83
• PF07969: Amidohydro_3
  • amino acids 261 to 436 (176 residues), 47.7 bits, E=1.7e-16

Best Hits

Swiss-Prot: 100% identical to GUAD_ECOLI: Guanine deaminase (guaD) from Escherichia coli (strain K12)

KEGG orthology group: K01487, guanine deaminase [EC: 3.5.4.3] (inferred from 100% identity to eco:b2883)

MetaCyc: 100% identical to guanine deaminase (Escherichia coli K-12 substr. MG1655)
Guanine deaminase. [EC: 3.5.4.3]

Predicted SEED Role

"Guanine deaminase (EC 3.5.4.3)" in subsystem Purine Utilization or Purine conversions (EC 3.5.4.3)

MetaCyc Pathways

• purine nucleotides degradation II (aerobic) (11/11 steps found)
• purine nucleotides degradation I (plants) (10/12 steps found)
• guanosine nucleotides degradation II (4/4 steps found)
• guanosine nucleotides degradation III (4/4 steps found)
• superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
• superpathway of purines degradation in plants (13/18 steps found)
• drosopterin and aurodrosopterin biosynthesis (5/7 steps found)
• purine nucleobases degradation II (anaerobic) (17/24 steps found)
• purine nucleobases degradation I (anaerobic) (6/15 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.3

Sequence Analysis Tools

See P76641 at UniProt or InterPro

Protein Sequence (439 amino acids)

>b2883 guanine deaminase (NCBI) (Escherichia coli BW25113)
MMSGEHTLKAVRGSFIDVTRTIDNPEEIASALRFIEDGLLLIKQGKVEWFGEWENGKHQI
PDTIRVRDYRGKLIVPGFVDTHIHYPQSEMVGAYGEQLLEWLNKHTFPTERRYEDLEYAR
EMSAFFIKQLLRNGTTTALVFGTVHPQSVDALFEAASHINMRMIAGKVMMDRNAPDYLLD
TAESSYHQSKELIERWHKNGRLLYAITPRFAPTSSPEQMAMAQRLKEEYPDTWVHTHLCE
NKDEIAWVKSLYPDHDGYLDVYHQYGLTGKNCVFAHCVHLEEKEWDRLSETKSSIAFCPT
SNLYLGSGLFNLKKAWQKKVKVGMGTDIGAGTTFNMLQTLNEAYKVLQLQGYRLSAYEAF
YLATLGGAKSLGLDDLIGNFLPGKEADFVVMEPTATPLQQLRYDNSVSLVDKLFVMMTLG
DDRSIYRTYVDGRLVYERN