Protein Info for b2883 in Escherichia coli BW25113

Name: guaD
Annotation: guanine deaminase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 439 TIGR02967: guanine deaminase" amino acids 33 to 432 (400 residues), 633.5 bits, see alignment E=7.6e-195 PF01979: Amidohydro_1" amino acids 74 to 435 (362 residues), 268.3 bits, see alignment E=1.1e-83 PF07969: Amidohydro_3" amino acids 261 to 436 (176 residues), 47.7 bits, see alignment E=1.7e-16

Best Hits

Swiss-Prot: 100% identical to GUAD_ECOLI: Guanine deaminase (guaD) from Escherichia coli (strain K12)

KEGG orthology group: K01487, guanine deaminase [EC: 3.5.4.3] (inferred from 100% identity to eco:b2883)

MetaCyc: 100% identical to guanine deaminase (Escherichia coli K-12 substr. MG1655)
Guanine deaminase. [EC: 3.5.4.3]

Predicted SEED Role

"Guanine deaminase (EC 3.5.4.3)" in subsystem Purine Utilization or Purine conversions (EC 3.5.4.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76641 at UniProt or InterPro

Protein Sequence (439 amino acids)

>b2883 guanine deaminase (NCBI) (Escherichia coli BW25113)
MMSGEHTLKAVRGSFIDVTRTIDNPEEIASALRFIEDGLLLIKQGKVEWFGEWENGKHQI
PDTIRVRDYRGKLIVPGFVDTHIHYPQSEMVGAYGEQLLEWLNKHTFPTERRYEDLEYAR
EMSAFFIKQLLRNGTTTALVFGTVHPQSVDALFEAASHINMRMIAGKVMMDRNAPDYLLD
TAESSYHQSKELIERWHKNGRLLYAITPRFAPTSSPEQMAMAQRLKEEYPDTWVHTHLCE
NKDEIAWVKSLYPDHDGYLDVYHQYGLTGKNCVFAHCVHLEEKEWDRLSETKSSIAFCPT
SNLYLGSGLFNLKKAWQKKVKVGMGTDIGAGTTFNMLQTLNEAYKVLQLQGYRLSAYEAF
YLATLGGAKSLGLDDLIGNFLPGKEADFVVMEPTATPLQQLRYDNSVSLVDKLFVMMTLG
DDRSIYRTYVDGRLVYERN