Protein Info for b2841 in Escherichia coli BW25113

Name: araE
Annotation: arabinose transporter (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 transmembrane" amino acids 23 to 50 (28 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 91 to 110 (20 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 258 to 281 (24 residues), see Phobius details amino acids 297 to 318 (22 residues), see Phobius details amino acids 329 to 348 (20 residues), see Phobius details amino acids 360 to 383 (24 residues), see Phobius details amino acids 396 to 422 (27 residues), see Phobius details amino acids 428 to 446 (19 residues), see Phobius details TIGR00879: MFS transporter, sugar porter (SP) family" amino acids 6 to 457 (452 residues), 496.4 bits, see alignment E=4.3e-153 PF06609: TRI12" amino acids 17 to 211 (195 residues), 37.1 bits, see alignment E=2.2e-13 PF00083: Sugar_tr" amino acids 26 to 460 (435 residues), 456.4 bits, see alignment E=1.7e-140 PF07690: MFS_1" amino acids 30 to 377 (348 residues), 130.7 bits, see alignment E=9.3e-42

Best Hits

Swiss-Prot: 100% identical to ARAE_ECOLI: Arabinose-proton symporter (araE) from Escherichia coli (strain K12)

KEGG orthology group: K02100, MFS transporter, SP family, arabinose:H+ symporter (inferred from 100% identity to eco:b2841)

MetaCyc: 100% identical to arabinose:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-10

Predicted SEED Role

"Arabinose-proton symporter" in subsystem L-Arabinose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AE24 at UniProt or InterPro

Protein Sequence (472 amino acids)

>b2841 arabinose transporter (NCBI) (Escherichia coli BW25113)
MVTINTESALTPRSLRDTRRMNMFVSVAAAVAGLLFGLDIGVIAGALPFITDHFVLTSRL
QEWVVSSMMLGAAIGALFNGWLSFRLGRKYSLMAGAILFVLGSIGSAFATSVEMLIAARV
VLGIAVGIASYTAPLYLSEMASENVRGKMISMYQLMVTLGIVLAFLSDTAFSYSGNWRAM
LGVLALPAVLLIILVVFLPNSPRWLAEKGRHIEAEEVLRMLRDTSEKAREELNEIRESLK
LKQGGWALFKINRNVRRAVFLGMLLQAMQQFTGMNIIMYYAPRIFKMAGFTTTEQQMIAT
LVVGLTFMFATFIAVFTVDKAGRKPALKIGFSVMALGTLVLGYCLMQFDNGTASSGLSWL
SVGMTMMCIAGYAMSAAPVVWILCSEIQPLKCRDFGITCSTTTNWVSNMIIGATFLTLLD
SIGAAGTFWLYTALNIAFVGITFWLIPETKNVTLEHIERKLMAGEKLRNIGV