Protein Info for b2834 in Escherichia coli BW25113

Name: tas
Annotation: predicted oxidoreductase, NADP(H)-dependent aldo-keto reductase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 PF00248: Aldo_ket_red" amino acids 16 to 337 (322 residues), 237.2 bits, see alignment E=1.1e-74

Best Hits

Swiss-Prot: 100% identical to TAS_SHIFL: Protein tas (tas) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to eco:b2834)

Predicted SEED Role

"Oxidoreductase, aldo/keto reductase family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A9T4 at UniProt or InterPro

Protein Sequence (346 amino acids)

>b2834 predicted oxidoreductase, NADP(H)-dependent aldo-keto reductase (NCBI) (Escherichia coli BW25113)
MQYHRIPHSSLEVSTLGLGTMTFGEQNSEADAHAQLDYAVAQGINLIDVAEMYPVPPRPE
TQGLTETYVGNWLAKHGSREKLIIASKVSGPSRNNDKGIRPDQALDRKNIREALHDSLKR
LQTDYLDLYQVHWPQRPTNCFGKLGYSWTDSAPAVSLLDTLDALAEYQRAGKIRYIGVSN
ETAFGVMRYLHLADKHDLPRIVTIQNPYSLLNRSFEVGLAEVSQYEGVELLAYSCLGFGT
LTGKYLNGAKPAGARNTLFSRFTRYSGEQTQKAVAAYVDIARRHGLDPAQMALAFVRRQP
FVASTLLGATTMDQLKTNIESLHLELSEDVLAEIEAVHQVYTYPAP