Protein Info for b2830 in Escherichia coli BW25113

Name: nudH
Annotation: dinucleoside polyphosphate hydrolase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 PF00293: NUDIX" amino acids 7 to 142 (136 residues), 91.5 bits, see alignment E=2.4e-30

Best Hits

Swiss-Prot: 100% identical to RPPH_ECOL6: RNA pyrophosphohydrolase (rppH) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K08311, putative (di)nucleoside polyphosphate hydrolase [EC: 3.6.1.-] (inferred from 100% identity to eco:b2830)

MetaCyc: 100% identical to RNA pyrophosphohydrolase (Escherichia coli K-12 substr. MG1655)
3.6.1.-; 3.6.1.-

Predicted SEED Role

"Adenosine (5')-pentaphospho-(5'')-adenosine pyrophosphohydrolase (EC 3.6.1.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A776 at UniProt or InterPro

Protein Sequence (176 amino acids)

>b2830 dinucleoside polyphosphate hydrolase (NCBI) (Escherichia coli BW25113)
MIDDDGYRPNVGIVICNRQGQVMWARRFGQHSWQFPQGGINPGESAEQAMYRELFEEVGL
SRKDVRILASTRNWLRYKLPKRLVRWDTKPVCIGQKQKWFLLQLVSGDAEINMQTSSTPE
FDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMSLQENTPKPQNASAYRRKRG