Protein Info for b2818 in Escherichia coli BW25113

Name: argA
Annotation: N-acetylglutamate synthase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01890: amino-acid N-acetyltransferase
  • amino acids 9 to 442 (434 residues), 654.1 bits, E=5e-201
• PF00696: AA_kinase
  • amino acids 26 to 269 (244 residues), 130.5 bits, E=1.3e-41
• PF00583: Acetyltransf_1
  • amino acids 327 to 413 (87 residues), 43.1 bits, E=7.2e-15
• PF13508: Acetyltransf_7
  • amino acids 336 to 414 (79 residues), 35.6 bits, E=1.5e-12

Best Hits

Swiss-Prot: 100% identical to ARGA_ECO57: Amino-acid acetyltransferase (argA) from Escherichia coli O157:H7

KEGG orthology group: K14682, amino-acid N-acetyltransferase [EC: 2.3.1.1] (inferred from 100% identity to eco:b2818)

MetaCyc: 100% identical to N-acetylglutamate synthase (Escherichia coli K-12 substr. MG1655)
Amino-acid N-acetyltransferase. [EC: 2.3.1.1]

Predicted SEED Role

"N-acetylglutamate synthase (EC 2.3.1.1)" in subsystem Arginine Biosynthesis extended (EC 2.3.1.1)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (16/17 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis II (acetyl cycle) (9/10 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.1

Sequence Analysis Tools

See P0A6C5 at UniProt or InterPro

Protein Sequence (443 amino acids)

>b2818 N-acetylglutamate synthase (NCBI) (Escherichia coli BW25113)
MVKERKTELVEGFRHSVPYINTHRGKTFVIMLGGEAIEHENFSSIVNDIGLLHSLGIRLV
VVYGARPQIDANLAAHHHEPLYHKNIRVTDAKTLELVKQAAGTLQLDITARLSMSLNNTP
LQGAHINVVSGNFIIAQPLGVDDGVDYCHSGRIRRIDEDAIHRQLDSGAIVLMGPVAVSV
TGESFNLTSEEIATQLAIKLKAEKMIGFCSSQGVTNDDGDIVSELFPNEAQARVEAQEEK
GDYNSGTVRFLRGAVKACRSGVRRCHLISYQEDGALLQELFSRDGIGTQIVMESAEQIRR
ATINDIGGILELIRPLEQQGILVRRSREQLEMEIDKFTIIQRDNTTIACAALYPFPEEKI
GEMACVAVHPDYRSSSRGEVLLERIAAQAKQSGLSKLFVLTTRSIHWFQERGFTPVDIDL
LPESKKQLYNYQRKSKVLMADLG