Protein Info for b2817 in Escherichia coli BW25113

Name: b2817
Annotation: putative amidase (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF11741: AMIN" amino acids 38 to 141 (104 residues), 74.5 bits, see alignment E=6.4e-25 PF01520: Amidase_3" amino acids 190 to 404 (215 residues), 170.9 bits, see alignment E=2.7e-54

Best Hits

Swiss-Prot: 100% identical to AMIC_ECOLI: N-acetylmuramoyl-L-alanine amidase AmiC (amiC) from Escherichia coli (strain K12)

KEGG orthology group: K01448, N-acetylmuramoyl-L-alanine amidase [EC: 3.5.1.28] (inferred from 100% identity to eco:b2817)

MetaCyc: 100% identical to N-acetylmuramoyl-L-alanine amidase C (Escherichia coli K-12 substr. MG1655)
N-acetylmuramoyl-L-alanine amidase. [EC: 3.5.1.28]

Predicted SEED Role

"N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)" (EC 3.5.1.28)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.28

Use Curated BLAST to search for 3.5.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P63883 at UniProt or InterPro

Protein Sequence (417 amino acids)

>b2817 putative amidase (VIMSS) (Escherichia coli BW25113)
MSGSNTAISRRRLLQGAGAMWLLSVSQVSLAAVSQVVAVRVWPASSYTRVTVESNRQLKY
KQFALSNPERVVVDIEDVNLNSVLKGMAAQIRADDPFIKSARVGQFDPQTVRMVFELKQN
VKPQLFALAPVAGFKERLVMDLYPANAQDMQDPLLALLEDYNKGDLEKQVPPAQSGPQPG
KAGRDRPIVIMLDPGHGGEDSGAVGKYKTREKDVVLQIARRLRSLIEKEGNMKVYMTRNE
DIFIPLQVRVAKAQKQRADLFVSIHADAFTSRQPSGSSVFALSTKGATSTAAKYLAQTQN
ASDLIGGVSKSGDRYVDHTMFDMVQSLTIADSLKFGKAVLNKLGKINKLHKNQVEQAGFA
VLKAPDIPSILVETAFISNVEEERKLKTATFQQEVAESILAGIKAYFADGATLARRG