Protein Info for b2811 in Escherichia coli BW25113

Name: ygdK
Annotation: predicted Fe-S metabolism protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 TIGR03391: cysteine desulfurase, sulfur acceptor subunit CsdE" amino acids 7 to 143 (137 residues), 241.9 bits, see alignment E=8.9e-77 PF02657: SufE" amino acids 23 to 140 (118 residues), 131.3 bits, see alignment E=8.8e-43

Best Hits

Swiss-Prot: 100% identical to CSDE_ECO57: Sulfur acceptor protein CsdE (csdE) from Escherichia coli O157:H7

KEGG orthology group: K02426, cysteine desulfuration protein SufE (inferred from 100% identity to eco:b2811)

MetaCyc: 100% identical to sulfur acceptor protein CsdE (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Cysteine desulfurase CsdA-CsdE, sulfur acceptor protein CsdE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AGF2 at UniProt or InterPro

Protein Sequence (147 amino acids)

>b2811 predicted Fe-S metabolism protein (NCBI) (Escherichia coli BW25113)
MTNPQFAGHPFGTTVTAETLRNTFAPLTQWEDKYRQLIMLGKQLPALPDELKAQAKEIAG
CENRVWLGYTVAENGKMHFFGDSEGRIVRGLLAVLLTAVEGKTAAELQAQSPLALFDELG
LRAQLSASRSQGLNALSEAIIAATKQV