Protein Info for b2807 in Escherichia coli BW25113

Name: ygdD
Annotation: conserved inner membrane protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 40 to 61 (22 residues), see Phobius details amino acids 68 to 91 (24 residues), see Phobius details amino acids 97 to 121 (25 residues), see Phobius details PF04241: DUF423" amino acids 20 to 106 (87 residues), 82.9 bits, see alignment E=7.7e-28

Best Hits

Swiss-Prot: 100% identical to YGDD_ECOL6: UPF0382 inner membrane protein YgdD (ygdD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 100% identity to eco:b2807)

Predicted SEED Role

"COG2363"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ADR2 at UniProt or InterPro

Protein Sequence (131 amino acids)

>b2807 conserved inner membrane protein (NCBI) (Escherichia coli BW25113)
MTSRFMLIFAAISGFIFVALGAFGAHVLSKTMGAVEMGWIQTGLEYQAFHTLAILGLAVA
MQRRISIWFYWSSVFLALGTVLFSGSLYCLALSHLRLWAFVTPVGGVSFLAGWALMLVGA
IRLKRKGVSHE