Protein Info for b2805 in Escherichia coli BW25113

Name: fucR
Annotation: DNA-binding transcriptional activator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 PF08220: HTH_DeoR" amino acids 5 to 60 (56 residues), 75.6 bits, see alignment E=5.1e-25 PF08279: HTH_11" amino acids 5 to 48 (44 residues), 36.3 bits, see alignment 1.1e-12 PF00455: DeoRC" amino acids 76 to 233 (158 residues), 154.7 bits, see alignment E=5.1e-49

Best Hits

Swiss-Prot: 100% identical to FUCR_ECOLI: L-fucose operon activator (fucR) from Escherichia coli (strain K12)

KEGG orthology group: K02430, DeoR family transcriptional regulator, L-fucose operon activator (inferred from 100% identity to eco:b2805)

Predicted SEED Role

"L-fucose operon activator" in subsystem L-fucose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0ACK8 at UniProt or InterPro

Protein Sequence (243 amino acids)

>b2805 DNA-binding transcriptional activator (NCBI) (Escherichia coli BW25113)
MKAARQQAIVDLLLNHTSLTTEALSEQLKVSKETIRRDLNELQTQGKILRNHGRAKYIHR
QNQDSGDPFHIRLKSHYAHKADIAREALAWIEEGMVIALDASSTCWYLARQLPDINIQVF
TNSHPICHELGKRERIQLISSGGTLERKYGCYVNPSLISQLKSLEIDLFIFSCEGIDSSG
ALWDSNAINADYKSMLLKRAAQSLLLIDKSKFNRSGEARIGHLDEVTHIISDERQVATSL
VTA