Protein Info for b2780 in Escherichia coli BW25113

Name: pyrG
Annotation: CTP synthetase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 545 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR00337: CTP synthase" amino acids 2 to 535 (534 residues), 882.9 bits, see alignment E=3.5e-270 PF06418: CTP_synth_N" amino acids 5 to 266 (262 residues), 423.1 bits, see alignment E=6.6e-131 PF00117: GATase" amino acids 301 to 534 (234 residues), 148.8 bits, see alignment E=2.3e-47 PF07722: Peptidase_C26" amino acids 438 to 517 (80 residues), 23.1 bits, see alignment E=8.7e-09

Best Hits

Swiss-Prot: 100% identical to PYRG_SHIF8: CTP synthase (pyrG) from Shigella flexneri serotype 5b (strain 8401)

KEGG orthology group: K01937, CTP synthase [EC: 6.3.4.2] (inferred from 100% identity to eco:b2780)

MetaCyc: 100% identical to CTP synthetase (Escherichia coli K-12 substr. MG1655)
CTP synthase. [EC: 6.3.4.2]

Predicted SEED Role

"CTP synthase (EC 6.3.4.2)" (EC 6.3.4.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A7E5 at UniProt or InterPro

Protein Sequence (545 amino acids)

>b2780 CTP synthetase (NCBI) (Escherichia coli BW25113)
MTTNYIFVTGGVVSSLGKGIAAASLAAILEARGLNVTIMKLDPYINVDPGTMSPIQHGEV
FVTEDGAETDLDLGHYERFIRTKMSRRNNFTTGRIYSDVLRKERRGDYLGATVQVIPHIT
NAIKERVLEGGEGHDVVLVEIGGTVGDIESLPFLEAIRQMAVEIGREHTLFMHLTLVPYM
AASGEVKTKPTQHSVKELLSIGIQPDILICRSDRAVPANERAKIALFCNVPEKAVISLKD
VDSIYKIPGLLKSQGLDDYICKRFSLNCPEANLSEWEQVIFEEANPVSEVTIGMVGKYIE
LPDAYKSVIEALKHGGLKNRVSVNIKLIDSQDVETRGVEILKGLDAILVPGGFGYRGVEG
MITTARFARENNIPYLGICLGMQVALIDYARHVANMENANSTEFVPDCKYPVVALITEWR
DENGNVEVRSEKSDLGGTMRLGAQQCQLVDDSLVRQLYNAPTIVERHRHRYEVNNMLLKQ
IEDAGLRVAGRSGDDQLVEIIEVPNHPWFVACQFHPEFTSTPRDGHPLFAGFVKAASEFQ
KRQAK