Protein Info for b2778 in Escherichia coli BW25113

Name: ygcG
Annotation: orf, hypothetical protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 176 to 194 (19 residues), see Phobius details amino acids 203 to 222 (20 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details PF04536: TPM_phosphatase" amino acids 29 to 152 (124 residues), 132.6 bits, see alignment E=3.9e-43

Best Hits

Swiss-Prot: 100% identical to YGCG_ECOLI: UPF0603 protein YgcG (ygcG) from Escherichia coli (strain K12)

KEGG orthology group: K06872, (no description) (inferred from 100% identity to eco:b2778)

Predicted SEED Role

"Uncharacterized protein YgcG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P55140 at UniProt or InterPro

Protein Sequence (290 amino acids)

>b2778 orf, hypothetical protein (VIMSS) (Escherichia coli BW25113)
MRYFILMFTFVCSFVAAQPTIVPQLQQQVTDLTSSLNSQEKKELTHKLESIFNNTQVQIA
VLIVPTTKDETIEQYATRVFDNWRLGDAKRNDGILIVVAWSDRTVRIQVGYGLEEKVTDA
LAGDIIRSNMIPAFKQQKLAKGLELAINALNNQLTSQHQYPTNPSESESASSSDHYYFAI
FWVFAVMFFPFWFFHQGSNFCRACKSGVCISAIYLLDLFLFSDKIFSIAVFSFFFTFTIF
MVFTCLCVLQKRASGRSYHSDNSGSAGGSDSGGFSGGGGSSGGGGASGRW