Protein Info for b2771 in Escherichia coli BW25113

Name: ygcS
Annotation: putative transport protein (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 54 to 76 (23 residues), see Phobius details amino acids 86 to 104 (19 residues), see Phobius details amino acids 110 to 132 (23 residues), see Phobius details amino acids 143 to 167 (25 residues), see Phobius details amino acids 173 to 194 (22 residues), see Phobius details amino acids 250 to 270 (21 residues), see Phobius details amino acids 282 to 305 (24 residues), see Phobius details amino acids 312 to 333 (22 residues), see Phobius details amino acids 339 to 358 (20 residues), see Phobius details amino acids 370 to 394 (25 residues), see Phobius details amino acids 400 to 421 (22 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 364 (338 residues), 114.8 bits, see alignment E=4.3e-37 amino acids 307 to 426 (120 residues), 36.7 bits, see alignment E=2.4e-13 PF00083: Sugar_tr" amino acids 29 to 429 (401 residues), 178.2 bits, see alignment E=2.9e-56

Best Hits

Swiss-Prot: 100% identical to YGCS_ECOLI: Inner membrane metabolite transport protein YgcS (ygcS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2771)

Predicted SEED Role

"Inner membrane metabolite transport protein YgcS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q46909 at UniProt or InterPro

Protein Sequence (445 amino acids)

>b2771 putative transport protein (VIMSS) (Escherichia coli BW25113)
MNTSPVRMDDLPLNRFHCRIAALTFGAHLTDGYVLGVIGYAIIQLTPAMQLTPFMAGMIG
GSALLGLFLGSLVLGWISDHIGRQKIFTFSFLLITLASFLQFFATTPEHLIGLRILIGIG
LGGDYSVGHTLLAEFSPRRHRGILLGAFSVVWTVGYVLASIAGHHFISENPEAWRWLLAS
AALPALLITLLRWGTPESPRWLLRQGRFAEAHAIVHRYFGPHVLLGDEVVTATHKHIKTL
FSSRYWRRTAFNSVFFVCLVIPWFVIYTWLPTIAQTIGLEDALTASLMLNALLIVGALLG
LVLTHLLAHRKFLLGSFLLLAATLVVMACLPSGSSLTLLLFVLFSTTISAVSNLVGILPA
ESFPTDIRSLGVGFATAMSRLGAAVSTGLLPWVLAQWGMQVTLLLLATVLLVGFVVTWLW
APETKALPLVAAGNVGGANEHSVSV