Protein Info for b2761 in Escherichia coli BW25113

Name: ygcB
Annotation: conserved protein, member of DEAD box family (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 888 PF18019: Cas3_HD" amino acids 11 to 235 (225 residues), 152.4 bits, see alignment E=4.6e-48 TIGR01596: CRISPR-associated endonuclease Cas3-HD" amino acids 27 to 233 (207 residues), 71.5 bits, see alignment E=8.9e-24 PF04851: ResIII" amino acids 307 to 459 (153 residues), 32.3 bits, see alignment E=2.3e-11 PF00270: DEAD" amino acids 309 to 491 (183 residues), 39.4 bits, see alignment E=1.4e-13 TIGR01587: CRISPR-associated helicase Cas3" amino acids 309 to 715 (407 residues), 475.2 bits, see alignment E=1.3e-146 PF00271: Helicase_C" amino acids 556 to 669 (114 residues), 26.7 bits, see alignment E=1.4e-09 PF22590: Cas3-like_C_2" amino acids 567 to 671 (105 residues), 124.7 bits, see alignment E=4.9e-40

Best Hits

Swiss-Prot: 100% identical to CAS3_ECOLI: CRISPR-associated endonuclease/helicase Cas3 (ygcB) from Escherichia coli (strain K12)

KEGG orthology group: K07012, (no description) (inferred from 100% identity to eco:b2761)

Predicted SEED Role

"CRISPR-associated helicase Cas3" in subsystem CRISPRs

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P38036 at UniProt or InterPro

Protein Sequence (888 amino acids)

>b2761 conserved protein, member of DEAD box family (NCBI) (Escherichia coli BW25113)
MEPFKYICHYWGKSSKSLTKGNDIHLLIYHCLDVAAVADCWWDQSVVLQNTFCRNEMLSK
QRVKAWLLFFIALHDIGKFDIRFQYKSAESWLKLNPATPSLNGPSTQMCRKFNHGAAGLY
WFNQDSLSEQSLGDFFSFFDAAPHPYESWFPWVEAVTGHHGFILHSQDQDKSRWEMPASL
ASYAAQDKQAREEWISVLEALFLTPAGLSINDIPPDCSSLLAGFCSLADWLGSWTTTNTF
LFNEDAPSDINALRTYFQDRQQDASRVLELSGLVSNKRCYEGVHALLDNGYQPRQLQVLV
DALPVAPGLTVIEAPTGSGKTETALAYAWKLIDQQIADSVIFALPTQATANAMLTRMEAS
ASHLFSSPNLILAHGNSRFNHLFQSIKSRAITEQGQEEAWVQCCQWLSQSNKKVFLGQIG
VCTIDQVLISVLPVKHRFIRGLGIGRSVLIVDEVHAYDTYMNGLLEAVLKAQADVGGSVI
LLSATLPMKQKQKLLDTYGLHTDPVENNSAYPLINWRGVNGAQRFDLLAHPEQLPPRFSI
QPEPICLADMLPDLTMLERMIAAANAGAQVCLICNLVDVAQVCYQRLKELNNTQVDIDLF
HARFTLNDRREKENRVISNFGKNGKRNVGRILVATQVVEQSLDVDFDWLITQHCPADLLF
QRLGRLHRHHRKYRPAGFEIPVATILLPDGEGYGRHEHIYSNVRVMWRTQQHIEELNGAS
LFFPDAYRQWLDSIYDDAEMDEPEWVGNGMDKFESAECEKRFKARKVLQWAEEYSLQDND
ETILAVTRDGEMSLPLLPYVQTSSGKQLLDGQVYEDLSHEQQYEALALNRVNVPFTWKRS
FSEVVDEDGLLWLEGKQNLDGWVWQGNSIVITYTGDEGMTRVIPANPK