Protein Info for b2759 in Escherichia coli BW25113

Name: ygcK
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 TIGR02548: CRISPR type I-E/ECOLI-associated protein CasB/Cse2" amino acids 10 to 154 (145 residues), 113.2 bits, see alignment E=7.6e-37 PF09485: CRISPR_Cse2" amino acids 23 to 148 (126 residues), 38.2 bits, see alignment E=9.7e-14

Best Hits

Swiss-Prot: 100% identical to CSE2_ECOLI: CRISPR system Cascade subunit CasB (casB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2759)

MetaCyc: 100% identical to type I-E CRISPR system Cascade subunit CasB (Escherichia coli K-12 substr. MG1655)
RXN0-5435

Predicted SEED Role

"CRISPR-associated protein, Cse2 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P76632 at UniProt or InterPro

Protein Sequence (160 amino acids)

>b2759 hypothetical protein (NCBI) (Escherichia coli BW25113)
MADEIDAMALYRAWQQLDNGSCAQIRRVSEPDELRDIPAFYRLVQPFGWENPRHQQALLR
MVFCLSAGKNVIRHQDKKSEQTTGISLGRALANSGRINERRIFQLIRADRTADMVQLRRL
LTHAEPVLDWPLMARMLTWWGKRERQQLLEDFVLTTNKNA