Protein Info for b2758 in Escherichia coli BW25113

Name: ygcJ
Annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 TIGR01869: CRISPR-associated protein Cas7/Cse4/CasC, subtype I-E/ECOLI" amino acids 3 to 323 (321 residues), 430.8 bits, see alignment E=2.8e-133 PF09344: Cas_CT1975" amino acids 5 to 353 (349 residues), 334 bits, see alignment E=7.5e-104

Best Hits

Swiss-Prot: 100% identical to CASC_ECOLI: CRISPR system Cascade subunit CasC (casC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2758)

MetaCyc: 100% identical to type I-E CRISPR system Cascade subunit CasC (Escherichia coli K-12 substr. MG1655)
RXN0-5435

Predicted SEED Role

"CRISPR-associated protein, Cse4 family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q46899 at UniProt or InterPro

Protein Sequence (363 amino acids)

>b2758 hypothetical protein (NCBI) (Escherichia coli BW25113)
MSNFINIHVLISHSPSCLNRDDMNMQKDAIFGGKRRVRISSQSLKRAMRKSGYYAQNIGE
SSLRTIHLAQLRDVLRQKLGERFDQKIIDKTLALLSGKSVDEAEKISADAVTPWVVGEIA
WFCEQVAKAEADNLDDKKLLKVLKEDIAAIRVNLQQGVDIALSGRMATSGMMTELGKVDG
AMSIAHAITTHQVDSDIDWFTAVDDLQEQGSAHLGTQEFSSGVFYRYANINLAQLQENLG
GASREQALEIATHVVHMLATEVPGAKQRTYAAFNPADMVMVNFSDMPLSMANAFEKAVKA
KDGFLQPSIQAFNQYWDRVANGYGLNGAAAQFSLSDVDPITAQVKQMPTLEQLKSWVRNN
GEA