Protein Info for b2750 in Escherichia coli BW25113

Name: cysC
Annotation: adenylylsulfate kinase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00455: adenylyl-sulfate kinase
  • amino acids 10 to 193 (184 residues), 296.6 bits, E=3.1e-93
• PF01583: APS_kinase
  • amino acids 27 to 179 (153 residues), 243.2 bits, E=1.2e-76
• PF13671: AAA_33
  • amino acids 30 to 143 (114 residues), 32.5 bits, E=9.9e-12

Best Hits

Swiss-Prot: 100% identical to CYSC_SHISS: Adenylyl-sulfate kinase (cysC) from Shigella sonnei (strain Ss046)

KEGG orthology group: K00860, adenylylsulfate kinase [EC: 2.7.1.25] (inferred from 100% identity to eco:b2750)

MetaCyc: 100% identical to adenylyl-sulfate kinase (Escherichia coli K-12 substr. MG1655)
Adenylyl-sulfate kinase. [EC: 2.7.1.25]

Predicted SEED Role

"Adenylylsulfate kinase (EC 2.7.1.25)" in subsystem Cysteine Biosynthesis or O-Methyl Phosphoramidate Capsule Modification in Campylobacter (EC 2.7.1.25)

MetaCyc Pathways

• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (10/12 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• sulfate activation for sulfonation (2/2 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (6/10 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.25

Sequence Analysis Tools

See P0A6J1 at UniProt or InterPro

Protein Sequence (201 amino acids)

>b2750 adenylylsulfate kinase (NCBI) (Escherichia coli BW25113)
MALHDENVVWHSHPVTVQQRELHHGHRGVVLWFTGLSGSGKSTVAGALEEALHKLGVSTY
LLDGDNVRHGLCSDLGFSDADRKENIRRVGEVANLMVEAGLVVLTAFISPHRAERQMVRE
RVGEGRFIEVFVDTPLAICEARDPKGLYKKARAGELRNFTGIDSVYEAPESAEIHLNGEQ
LVTNLVQQLLDLLRQNDIIRS