Protein Info for b2743 in Escherichia coli BW25113

Name: pcm
Annotation: protein-L-isoaspartate O-methyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 TIGR00080: protein-L-isoaspartate O-methyltransferase" amino acids 2 to 207 (206 residues), 330.9 bits, see alignment E=1.9e-103 PF01135: PCMT" amino acids 5 to 206 (202 residues), 278.9 bits, see alignment E=4.3e-87 PF00398: RrnaAD" amino acids 61 to 134 (74 residues), 28.6 bits, see alignment E=1.2e-10 PF13649: Methyltransf_25" amino acids 79 to 149 (71 residues), 27.6 bits, see alignment E=6e-10

Best Hits

Swiss-Prot: 100% identical to PIMT_ECOLU: Protein-L-isoaspartate O-methyltransferase (pcm) from Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)

KEGG orthology group: K00573, protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC: 2.1.1.77] (inferred from 100% identity to eco:b2743)

MetaCyc: 100% identical to protein-L-isoaspartate O-methyltransferase (Escherichia coli K-12 substr. MG1655)
Protein-L-isoaspartate(D-aspartate) O-methyltransferase. [EC: 2.1.1.77]

Predicted SEED Role

"Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)" in subsystem Ton and Tol transport systems (EC 2.1.1.77)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A7A5 at UniProt or InterPro

Protein Sequence (208 amino acids)

>b2743 protein-L-isoaspartate O-methyltransferase (NCBI) (Escherichia coli BW25113)
MVSRRVQALLDQLRAQGIQDEQVLNALAAVPREKFVDEAFEQKAWDNIALPIGQGQTISQ
PYMVARMTELLELTPQSRVLEIGTGSGYQTAILAHLVQHVCSVERIKGLQWQARRRLKNL
DLHNVSTRHGDGWQGWQARAPFDAIIVTAAPPEIPTALMTQLDEGGILVLPVGEEHQYLK
RVRRRGGEFIIDTVEAVRFVPLVKGELA