Protein Info for b2730 in Escherichia coli BW25113

Name: hypE
Annotation: carbamoyl phosphate phosphatase, hydrogenase 3 maturation protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 TIGR02124: hydrogenase expression/formation protein HypE" amino acids 3 to 336 (334 residues), 468 bits, see alignment E=7.6e-145 PF00586: AIRS" amino acids 43 to 152 (110 residues), 75.7 bits, see alignment E=3.8e-25 PF02769: AIRS_C" amino acids 166 to 314 (149 residues), 95.6 bits, see alignment E=3.6e-31

Best Hits

Swiss-Prot: 100% identical to HYPE_ECOLI: Carbamoyl dehydratase HypE (hypE) from Escherichia coli (strain K12)

KEGG orthology group: K04655, hydrogenase expression/formation protein HypE (inferred from 100% identity to eco:b2730)

MetaCyc: 100% identical to carbamoyl dehydratase HypE (Escherichia coli K-12 substr. MG1655)
4.2.1.M8 [EC: 4.2.1.M8]; RXN-22648 [EC: 4.2.1.M8]

Predicted SEED Role

"[NiFe] hydrogenase metallocenter assembly protein HypE" in subsystem NiFe hydrogenase maturation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.M8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P24193 at UniProt or InterPro

Protein Sequence (336 amino acids)

>b2730 carbamoyl phosphate phosphatase, hydrogenase 3 maturation protein (RefSeq) (Escherichia coli BW25113)
MNNIQLAHGSGGQAMQQLINSLFMEAFANPWLAEQEDQARLDLAQLVAEGDRLAFSTDSY
VIDPLFFPGGNIGKLAICGTANDVAVSGAIPRYLSCGFILEEGLPMETLKAVVTSMAETA
RAAGIAIVTGDTKVVQRGAVDKLFINTAGMGAIPANIHWGAQTLTAGDVLLVSGTLGDHG
ATILNLREQLGLDGELVSDCAVLTPLIQTLRDIPGVKALRDATRGGVNAVVHEFAAACGC
GIELSEAALPVKPAVRGVCELLGLDALNFANEGKLVIAVERNAAEQVLAALHSHPLGKDA
ALIGEVVERKGVRLAGLYGVKRTLDLPHAEPLPRIC