Protein Info for b2719 in Escherichia coli BW25113

Name: hycG
Annotation: hydrogenase 3 and formate hydrogenase complex, HycG subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to HYCG_ECOLI: Formate hydrogenlyase subunit 7 (hycG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2719)

MetaCyc: 100% identical to hydrogenase 3 iron-sulfur protein HycG (Escherichia coli K-12 substr. MG1655)
Ferredoxin hydrogenase. [EC: 1.12.7.2]

Predicted SEED Role

"Formate hydrogenlyase subunit 7" in subsystem Formate hydrogenase

MetaCyc Pathways

superpathway of fermentation (Chlamydomonas reinhardtii) (8/9 steps found)
hydrogen production III (1/1 steps found)
hydrogen production VIII (1/1 steps found)
hydrogen production VI (1/2 steps found)
superpathway of hydrogen production (1/2 steps found)
superpathway of photosynthetic hydrogen production (3/6 steps found)
L-glutamate degradation VII (to butanoate) (5/12 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.12.7.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P16433 at UniProt or InterPro

Protein Sequence (255 amino acids)

>b2719 hydrogenase 3 and formate hydrogenase complex, HycG subunit (NCBI) (Escherichia coli BW25113)
MSNLLGPRDANGIPVPMTVDESIASMKASLLKKIKRSAYVYRVDCGGCNGCEIEIFATLS
PLFDAERFGIKVVPSPRHADILLFTGAVTRAMRSPALRAWQSAPDPKICISYGACGNSGG
IFHDLYCVWGGTDKIVPVDVYIPGCPPTPAATLYGFAMALGLLEQKIHARGPGELDEQPA
EILHGDMVQPLRVKVDREARRLAGYRYGRQIADDYLTQLGQGEEQVARWLEAENDPRLNE
IVSHLNHVVEEARIR