Protein Info for b2713 in Escherichia coli BW25113

Name: hydN
Annotation: formate dehydrogenase-H, [4Fe-4S] ferredoxin subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 PF12800: Fer4_4" amino acids 10 to 22 (13 residues), 13 bits, see alignment (E = 5.3e-05) amino acids 87 to 102 (16 residues), 24.7 bits, see alignment (E = 9.1e-09) PF13247: Fer4_11" amino acids 55 to 104 (50 residues), 34.5 bits, see alignment E=9e-12 PF12838: Fer4_7" amino acids 58 to 103 (46 residues), 28.5 bits, see alignment E=7.6e-10 PF13187: Fer4_9" amino acids 58 to 104 (47 residues), 27.6 bits, see alignment E=1.1e-09 PF12837: Fer4_6" amino acids 81 to 103 (23 residues), 33 bits, see alignment (E = 1.8e-11) PF12797: Fer4_2" amino acids 82 to 101 (20 residues), 28.3 bits, see alignment (E = 5.3e-10) PF00037: Fer4" amino acids 83 to 104 (22 residues), 32.1 bits, see alignment (E = 3.3e-11)

Best Hits

Swiss-Prot: 100% identical to HYDN_ECOL6: Electron transport protein HydN (hydN) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K05796, electron transport protein HydN (inferred from 100% identity to eco:b2713)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AAK4 at UniProt or InterPro

Protein Sequence (175 amino acids)

>b2713 formate dehydrogenase-H, [4Fe-4S] ferredoxin subunit (NCBI) (Escherichia coli BW25113)
MNRFIIADASKCIGCRTCEVACVVSHQENQDCASLTPETFLPRIHVIKGVNISTATVCRQ
CEDAPCANVCPNGAISRDKGFVHVMQERCIGCKTCVVACPYGAMEVVVRPVIRNSGAGLN
VRADKAEANKCDLCNHREDGPACMAACPTHALICVDRNKLEQLSAEKRRRTALMF