Protein Info for b2709 in Escherichia coli BW25113

Name: ygaA
Annotation: putative 2-component transcriptional regulator (VIMSS)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 PF01590: GAF" amino acids 22 to 154 (133 residues), 50 bits, see alignment E=1.8e-16 PF13185: GAF_2" amino acids 25 to 155 (131 residues), 31 bits, see alignment E=1.2e-10 PF00493: MCM" amino acids 180 to 329 (150 residues), 24.7 bits, see alignment E=4.6e-09 PF00158: Sigma54_activat" amino acids 187 to 353 (167 residues), 228.6 bits, see alignment E=1.5e-71 PF14532: Sigma54_activ_2" amino acids 188 to 358 (171 residues), 81.6 bits, see alignment E=2.7e-26 PF01078: Mg_chelatase" amino acids 193 to 311 (119 residues), 22.8 bits, see alignment E=2.1e-08 PF07728: AAA_5" amino acids 210 to 329 (120 residues), 24.9 bits, see alignment E=7.2e-09 PF00004: AAA" amino acids 211 to 343 (133 residues), 24 bits, see alignment E=1.8e-08

Best Hits

Swiss-Prot: 100% identical to NORR_ECODH: Anaerobic nitric oxide reductase transcription regulator NorR (norR) from Escherichia coli (strain K12 / DH10B)

KEGG orthology group: K12266, anaerobic nitric oxide reductase transcription regulator (inferred from 100% identity to eco:b2709)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P37013 at UniProt or InterPro

Protein Sequence (504 amino acids)

>b2709 putative 2-component transcriptional regulator (VIMSS) (Escherichia coli BW25113)
MSFSVDVLANIAIELQRGIGHQDRFQRLITTLRQVLECDASALLRYDSRQFIPLAIDGLA
KDVLGRRFALEGHPRLEAIARAGDVVRFPADSELPDPYDGLIPGQESLKVHACVGLPLFA
GQNLIGALTLDGMQPDQFDVFSDEELRLIAALAAGALSNALLIEQLESQNMLPGDATPFE
AVKQTQMIGLSPGMTQLKKEIEIVAASDLNVLISGETGTGKELVAKAIHEASPRAVNPLV
YLNCAALPESVAESELFGHVKGAFTGAISNRSGKFEMADNGTLFLDEIGELSLALQAKLL
RVLQYGDIQRVGDDRCLRVDVRVLAATNRDLREEVLAGRFRADLFHRLSVFPLSVPPLRE
RGDDVILLAGYFCEQCRLRQGLSRVVLSAGARNLLQHYSFPGNVRELEHAIHRAVVLARA
TRSGDEVILEAQHFAFPEVTLPTPEVAAVPVVKQNLREATEAFQRETIRQALAQNHHNWA
ACARMLETDVANLHRLAKRLGLKD