Protein Info for b2706 in Escherichia coli BW25113

Name: gutM
Annotation: DNA-binding transcriptional activator of glucitol operon (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 119 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF06923: GutM" amino acids 5 to 110 (106 residues), 112.9 bits, see alignment E=3.9e-37

Best Hits

Swiss-Prot: 100% identical to GUTM_ECOLI: Glucitol operon activator protein (gutM) from Escherichia coli (strain K12)

KEGG orthology group: K02466, glucitol operon activator protein (inferred from 100% identity to eco:b2706)

Predicted SEED Role

"Glucitol operon activator protein" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P15081 at UniProt or InterPro

Protein Sequence (119 amino acids)

>b2706 DNA-binding transcriptional activator of glucitol operon (NCBI) (Escherichia coli BW25113)
MVSALITVAVIAWCAQLALGGWQISRFNRAFDTLCQQGRVGVGRSSGRFKPRVVVAIALD
DQQRIVDTLFMKGLTVFARPQKIPAITGMHAGDLQPDVIFPHDPLSQNALSLALKLKRG