Protein Info for b2701 in Escherichia coli BW25113

Name: mltB
Annotation: membrane-bound lytic murein transglycosylase B (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13406: SLT_2
  • amino acids 57 to 353 (297 residues), 307.3 bits, E=5.1e-96
• TIGR02282: lytic murein transglycosylase B
  • amino acids 61 to 355 (295 residues), 433.5 bits, E=1.7e-134

Best Hits

Swiss-Prot: 100% identical to MLTB_ECOLI: Membrane-bound lytic murein transglycosylase B (mltB) from Escherichia coli (strain K12)

KEGG orthology group: K08305, membrane-bound lytic murein transglycosylase B [EC: 3.2.1.-] (inferred from 100% identity to eco:b2701)

MetaCyc: 100% identical to membrane-bound lytic murein transglycosylase B (Escherichia coli K-12 substr. MG1655)
4.2.2.f [EC: 4.2.2.f]; 4.2.2.f [EC: 4.2.2.f]

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.2.1.-)

MetaCyc Pathways

• peptidoglycan recycling I (14/14 steps found)
• peptidoglycan recycling II (7/10 steps found)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Nucleotide sugars metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.- or 4.2.2.f

Sequence Analysis Tools

See P41052 at UniProt or InterPro

Protein Sequence (361 amino acids)

>b2701 membrane-bound lytic murein transglycosylase B (NCBI) (Escherichia coli BW25113)
MFKRRYVTLLPLFVLLAACSSKPKPTETDTTTGTPSGGFLLEPQHNVMQMGGDFANNPNA
QQFIDKMVNKHGFDRQQLQEILSQAKRLDSVLRLMDNQAPTTSVKPPSGPNGAWLRYRKK
FITPDNVQNGVVFWNQYEDALNRAWQVYGVPPEIIVGIIGVETRWGRVMGKTRILDALAT
LSFNYPRRAEYFSGELETFLLMARDEQDDPLNLKGSFAGAMGYGQFMPSSYKQYAVDFSG
DGHINLWDPVDAIGSVANYFKAHGWVKGDQVAVMANGQAPGLPNGFKTKYSISQLAAAGL
TPQQPLGNHQQASLLRLDVGTGYQYWYGLPNFYTITRYNHSTHYAMAVWQLGQAVALARV
Q