Protein Info for b2686 in Escherichia coli BW25113

Name: emrB
Annotation: multidrug efflux system protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 512 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 232 to 251 (20 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details amino acids 303 to 324 (22 residues), see Phobius details amino acids 336 to 353 (18 residues), see Phobius details amino acids 366 to 389 (24 residues), see Phobius details amino acids 480 to 498 (19 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 13 to 498 (486 residues), 729.3 bits, see alignment E=1.1e-223 PF07690: MFS_1" amino acids 19 to 414 (396 residues), 187.5 bits, see alignment E=3.4e-59

Best Hits

Swiss-Prot: 100% identical to EMRB_ECO57: Multidrug export protein EmrB (emrB) from Escherichia coli O157:H7

KEGG orthology group: K03446, MFS transporter, DHA2 family, multidrug resistance protein B (inferred from 100% identity to eco:b2686)

MetaCyc: 100% identical to multidrug efflux pump membrane subunit EmrB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-363; TRANS-RXN-364; TRANS-RXN-365

Predicted SEED Role

"Multidrug resistance protein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AEJ0 at UniProt or InterPro

Protein Sequence (512 amino acids)

>b2686 multidrug efflux system protein (NCBI) (Escherichia coli BW25113)
MQQQKPLEGAQLVIMTIALSLATFMQVLDSTIANVAIPTIAGNLGSSLSQGTWVITSFGV
ANAISIPLTGWLAKRVGEVKLFLWSTIAFAIASWACGVSSSLNMLIFFRVIQGIVAGPLI
PLSQSLLLNNYPPAKRSIALALWSMTVIVAPICGPILGGYISDNYHWGWIFFINVPIGVA
VVLMTLQTLRGRETRTERRRIDAVGLALLVIGIGSLQIMLDRGKELDWFSSQEIIILTVV
AVVAICFLIVWELTDDNPIVDLSLFKSRNFTIGCLCISLAYMLYFGAIVLLPQLLQEVYG
YTATWAGLASAPVGIIPVILSPIIGRFAHKLDMRRLVTFSFIMYAVCFYWRAYTFEPGMD
FGASAWPQFIQGFAVACFFMPLTTITLSGLPPERLAAASSLSNFTRTLAGSIGTSITTTM
WTNRESMHHAQLTESVNPFNPNAQAMYSQLEGLGMTQQQASGWIAQQITNQGLIISANEI
FWMSAGIFLVLLGLVWFAKPPFGAGGGGGGAH