Protein Info for b2685 in Escherichia coli BW25113

Name: emrA
Annotation: multidrug efflux system (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 transmembrane" amino acids 23 to 44 (22 residues), see Phobius details TIGR00998: efflux pump membrane protein" amino acids 20 to 345 (326 residues), 496.3 bits, see alignment E=1.9e-153 PF25917: BSH_RND" amino acids 60 to 247 (188 residues), 38.3 bits, see alignment E=1.5e-13 PF25885: HH_EMRA" amino acids 95 to 216 (122 residues), 169 bits, see alignment E=7.4e-54 PF25963: Beta-barrel_AAEA" amino acids 253 to 339 (87 residues), 27.1 bits, see alignment E=5.4e-10

Best Hits

Swiss-Prot: 100% identical to EMRA_ECOLI: Multidrug export protein EmrA (emrA) from Escherichia coli (strain K12)

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 100% identity to eco:b2685)

MetaCyc: 100% identical to multidrug efflux pump membrane fusion protein EmrA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-363; TRANS-RXN-364; TRANS-RXN-365

Predicted SEED Role

"Multidrug resistance protein A (ErmA)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P27303 at UniProt or InterPro

Protein Sequence (390 amino acids)

>b2685 multidrug efflux system (NCBI) (Escherichia coli BW25113)
MSANAETQTPQQPVKKSGKRKRLLLLLTLLFIIIAVAIGIYWFLVLRHFEETDDAYVAGN
QIQIMSQVSGSVTKVWADNTDFVKEGDVLVTLDPTDARQAFEKAKTALASSVRQTHQLMI
NSKQLQANIEVQKIALAKAQSDYNRRVPLGNANLIGREELQHARDAVTSAQAQLDVAIQQ
YNANQAMILGTKLEDQPAVQQAATEVRNAWLALERTRIISPMTGYVSRRAVQPGAQISPT
TPLMAVVPATNMWVDANFKETQIANMRIGQPVTITTDIYGDDVKYTGKVVGLDMGTGSAF
SLLPAQNATGNWIKVVQRLPVRIELDQKQLEQYPLRIGLSTLVSVNTTNRDGQVLANKVR
STPVAVSTAREISLAPVNKLIDDIVKANAG