Protein Info for b2679 in Escherichia coli BW25113

Name: proX
Annotation: glycine betaine transporter subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF04069: OpuAC" amino acids 30 to 312 (283 residues), 179.3 bits, see alignment E=5.6e-57

Best Hits

Swiss-Prot: 100% identical to PROX_ECO57: Glycine betaine/proline betaine-binding periplasmic protein (proX) from Escherichia coli O157:H7

KEGG orthology group: K02002, glycine betaine/proline transport system substrate-binding protein (inferred from 100% identity to eco:b2679)

MetaCyc: 100% identical to glycine betaine ABC transporter periplasmic binding protein ProX (Escherichia coli K-12 substr. MG1655)
RXN-8638 [EC: 7.6.2.9]; 7.4.2.- [EC: 7.6.2.9]

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AFM2 at UniProt or InterPro

Protein Sequence (330 amino acids)

>b2679 glycine betaine transporter subunit (NCBI) (Escherichia coli BW25113)
MRHSVLFATAFATLISTQTFAADLPGKGITVNPVQSTITEETFQTLLVSRALEKLGYTVN
KPSEVDYNVGYTSLASGDATFTAVNWTPLHDNMYEAAGGDKKFYREGVFVNGAAQGYLID
KKTADQYKITNIAQLKDPKIAKLFDTNGDGKADLTGCNPGWGCEGAINHQLAAYELTNTV
THNQGNYAAMMADTISRYKEGKPVFYYTWTPYWVSNELKPGKDVVWLQVPFSALPGDKNA
DTKLPNGANYGFPVSTMHIVANKAWAEKNPAAAKLFAIMQLPVADINAQNAIMHDGKASE
GDIQGHVDGWIKAHQQQFDGWVNEALAAQK