Protein Info for b2676 in Escherichia coli BW25113

Name: nrdF
Annotation: ribonucleotide-diphosphate reductase beta subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 transmembrane" amino acids 152 to 172 (21 residues), see Phobius details TIGR04171: ribonucleoside-diphosphate reductase, class 1b, beta subunit" amino acids 7 to 319 (313 residues), 473.7 bits, see alignment E=1.4e-146 PF00268: Ribonuc_red_sm" amino acids 8 to 280 (273 residues), 301.9 bits, see alignment E=2.4e-94

Best Hits

Swiss-Prot: 100% identical to RIR4_ECOLI: Ribonucleoside-diphosphate reductase 2 subunit beta (nrdF) from Escherichia coli (strain K12)

KEGG orthology group: K00526, ribonucleoside-diphosphate reductase beta chain [EC: 1.17.4.1] (inferred from 100% identity to eco:b2676)

MetaCyc: 100% identical to ribonucleoside-diphosphate reductase 2 subunit beta (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Ribonucleotide reductase of class Ib (aerobic), beta subunit (EC 1.17.4.1)" in subsystem Ribonucleotide reduction (EC 1.17.4.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.17.4.1

Use Curated BLAST to search for 1.17.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P37146 at UniProt or InterPro

Protein Sequence (319 amino acids)

>b2676 ribonucleotide-diphosphate reductase beta subunit (NCBI) (Escherichia coli BW25113)
MKLSRISAINWNKISDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLTVVEQQLTMRVF
TGLTLLDTLQNVIGAPSLMPDALTPHEEAVLSNISFMEAVHARSYSSIFSTLCQTKDVDA
AYAWSEENAPLQRKAQIIQQHYRGDDPLKKKIASVFLESFLFYSGFWLPMYFSSRGKLTN
TADLIRLIIRDEAVHGYYIGYKYQKNMEKISLGQREELKSFAFDLLLELYDNELQYTDEL
YAETPWADDVKAFLCYNANKALMNLGYEPLFPAEMAEVNPAILAALSPNADENHDFFSGS
GSSYVMGKAVETEDEDWNF