Protein Info for b2668 in Escherichia coli BW25113

Name: ygaP
Annotation: predicted inner membrane protein with hydrolase activity (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 transmembrane" amino acids 117 to 134 (18 residues), see Phobius details amino acids 140 to 165 (26 residues), see Phobius details PF00581: Rhodanese" amino acids 7 to 99 (93 residues), 50.3 bits, see alignment E=2.9e-17 PF11127: YgaP-like_TM" amino acids 115 to 166 (52 residues), 33.9 bits, see alignment E=2.7e-12

Best Hits

Swiss-Prot: 100% identical to YGAP_ECOLI: Inner membrane protein YgaP (ygaP) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2668)

MetaCyc: 100% identical to thiosulfate sulfurtransferase YgaP (Escherichia coli K-12 substr. MG1655)
Thiosulfate sulfurtransferase. [EC: 2.8.1.1]

Predicted SEED Role

"Rhodanese-related sulfurtransferases"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.1

Use Curated BLAST to search for 2.8.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P55734 at UniProt or InterPro

Protein Sequence (174 amino acids)

>b2668 predicted inner membrane protein with hydrolase activity (NCBI) (Escherichia coli BW25113)
MALTTISPHDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSVLEQSGLPAKLRHEQI
IFHCQAGKRTSNNADKLAAIAAPAEIFLLEDGIDGWKKAGLPVAVNKSQPLPLMRQVQIA
AGGLILIGVVLGYTVNSGFFLLSGFVGAGLLFAGISGFCGMARLLDKMPWNQRA