Protein Info for b2634 in Escherichia coli BW25113

Name: yfjR
Annotation: CP4-57 prophage; predicted DNA-binding transcriptional regulator (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF08279: HTH_11" amino acids 14 to 48 (35 residues), 21.6 bits, see alignment 3.2e-08 PF08220: HTH_DeoR" amino acids 14 to 50 (37 residues), 25.5 bits, see alignment 1.7e-09 PF13280: WYL" amino acids 129 to 197 (69 residues), 35.2 bits, see alignment E=2.5e-12

Best Hits

Swiss-Prot: 100% identical to YFJR_ECOLI: Uncharacterized HTH-type transcriptional regulator YfjR (yfjR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2634)

Predicted SEED Role

"FIG00641766: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P52133 at UniProt or InterPro

Protein Sequence (233 amino acids)

>b2634 CP4-57 prophage; predicted DNA-binding transcriptional regulator (NCBI) (Escherichia coli BW25113)
MTQAERRHDRLAVRLSLIISRLVAGETLSVRKLAAEFGVSVRTLRRDFRERLMYLDLEYQ
SGYCRLRTAGSEMQMVPDVLIFAHRSGLAGLFPGLDRRLVNALLMCDESPCVIAPANPVP
SPSGALSFWRLIQAITGRRRVTLIAEGRRCERLAPCRLLIHQQTWYLVAEHEGHIAVFTL
DEIHLIQPLQETFRRNDSLCRLVEDPVFIQALPHFRFIQHSLLTFVPADSPPE