Protein Info for b2625 in Escherichia coli BW25113

Name: yfjI
Annotation: CP4-57 prophage; predicted protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 PF13148: DUF3987" amino acids 28 to 388 (361 residues), 360.6 bits, see alignment E=5.4e-112

Best Hits

Swiss-Prot: 100% identical to YFJI_ECOLI: Protein YfjI (yfjI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b2625)

Predicted SEED Role

"Hyphotheical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P52124 at UniProt or InterPro

Protein Sequence (469 amino acids)

>b2625 CP4-57 prophage; predicted protein (NCBI) (Escherichia coli BW25113)
MFNGRPFPVDAFPKIIRNAIYEVEQHTQAPQGLIAASALGVISLACQNRIDVCRLNNLRG
PVSLFLMTLAESGERKSTVDKLLMKPLYQLEEDLFEKYTHDLTAWRNDEAIFNIEKKALM
SKLKSDIRRNKDHLATNERLKELLTTNPKAPVRFKFLFNDATPAAIKAHLCGHWRSVGIM
SDEAGIIFNGYTLNELPFINKMWDGSIFTVERKNEPEKLIRDARITLSLMVQPNVFKGYI
DRKGDMAKGIGFFARCLMCQPASTQGNRKISNPIFSNEHLPVFHQRLMEIVNESIIKINE
NNRICLRFSAEAERHWIEFYNQVESEMRMIGLLYDFKDYASKMAENMARLAALLHYFSGD
GGDISVTAVKAAVEIVAWYIEEYIRLFSKKEEFSLDVSEADELYCWIKDYCTQKFSSCIK
KNIILQFGPNKFRNRDKANELIRILISQNKIFISSWGKTKIINITHCVF