Protein Info for b2609 in Escherichia coli BW25113
Name: rpsP
Annotation: 30S ribosomal protein S16 (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RS16_SHIBS: 30S ribosomal protein S16 (rpsP) from Shigella boydii serotype 4 (strain Sb227)
KEGG orthology group: K02959, small subunit ribosomal protein S16 (inferred from 100% identity to eco:b2609)MetaCyc: 100% identical to 30S ribosomal subunit protein S16 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"SSU ribosomal protein S16p" in subsystem Ribosome SSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P0A7T3 at UniProt or InterPro
Protein Sequence (82 amino acids)
>b2609 30S ribosomal protein S16 (NCBI) (Escherichia coli BW25113) MVTIRLARHGAKKRPFYQVVVADSRNARNGRFIERVGFFNPIASEKEEGTRLDLDRIAHW VGQGATISDRVAALIKEVNKAA