Protein Info for b2581 in Escherichia coli BW25113

Name: yfiF
Annotation: predicted methyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 PF08032: SpoU_sub_bind" amino acids 110 to 181 (72 residues), 55 bits, see alignment E=8.7e-19 PF00588: SpoU_methylase" amino acids 199 to 336 (138 residues), 110 bits, see alignment E=1e-35

Best Hits

Swiss-Prot: 100% identical to YFIF_ECO57: Uncharacterized tRNA/rRNA methyltransferase YfiF (yfiF) from Escherichia coli O157:H7

KEGG orthology group: K03214, RNA methyltransferase, TrmH family [EC: 2.1.1.-] (inferred from 100% identity to eco:b2581)

Predicted SEED Role

"hypothetical tRNA/rRNA methyltransferase yfiF [EC:2.1.1.-]"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AGJ5 at UniProt or InterPro

Protein Sequence (345 amino acids)

>b2581 predicted methyltransferase (NCBI) (Escherichia coli BW25113)
MNDEMKGKSGKVKVMYVRSDDDSDKRTHNPRTGKGGGRPGKSRADGGRRPARDDKQSQPR
DRKWEDSPWRTVSRAPGDETPEKADHGGISGKSFIDPEVLRRQRAEETRVYGENACQALF
QSRPEAIVRAWFIQSVTPRFKEALRWMAANRKAYHVVDEAELTKASGTEHHGGVCFLIKK
RNGTTVQQWVSQAGAQDCVLALENESNPHNLGGMMRSCAHFGVKGVVVQDAALLESGAAI
RTAEGGAEHVQPITGDNIVNVLDDFRQAGYTVVTTSSEQGKPLFKTSLPAKMVLVLGQEY
EGLPDAARDPNDLRVKIDGTGNVAGLNISVATGVLLGEWWRQNKA