Protein Info for b2578 in Escherichia coli BW25113
Name: yfiK
Annotation: neutral amino-acid efflux system (NCBI)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to EAMB_ECOLI: Cysteine/O-acetylserine efflux protein (eamB) from Escherichia coli (strain K12)
KEGG orthology group: K11249, cysteine/O-acetylserine efflux protein (inferred from 100% identity to eco:b2578)MetaCyc: 100% identical to cysteine/O-acetylserine exporter EamB (Escherichia coli K-12 substr. MG1655)
RXN0-1923; RXN0-1924
Predicted SEED Role
"Transporter, LysE family"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P38101 at UniProt or InterPro
Protein Sequence (195 amino acids)
>b2578 neutral amino-acid efflux system (NCBI) (Escherichia coli BW25113) MTPTLLSAFWTYTLITAMTPGPNNILALSSATSHGFRQSTRVLAGMSLGFLIVMLLCAGI SFSLAVIDPAAVHLLSWAGAAYIVWLAWKIATSPTKEDGLQAKPISFWASFALQFVNVKI ILYGVTALSTFVLPQTQALSWVVGVSVLLAMIGTFGNVCWALAGHLFQRLFRQYGRQLNI VLALLLVYCAVRIFY