Protein Info for b2570 in Escherichia coli BW25113

Name: rseC
Annotation: RseC protein involved in reduction of the SoxR iron-sulfur cluster (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 transmembrane" amino acids 74 to 98 (25 residues), see Phobius details amino acids 104 to 121 (18 residues), see Phobius details PF04246: RseC_MucC" amino acids 8 to 139 (132 residues), 124.7 bits, see alignment E=1.2e-40

Best Hits

Swiss-Prot: 100% identical to RSEC_ECOLI: Protein RseC (rseC) from Escherichia coli (strain K12)

KEGG orthology group: K03803, sigma-E factor negative regulatory protein RseC (inferred from 100% identity to eco:b2570)

Predicted SEED Role

"Sigma factor RpoE regulatory protein RseC" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P46187 at UniProt or InterPro

Protein Sequence (159 amino acids)

>b2570 RseC protein involved in reduction of the SoxR iron-sulfur cluster (NCBI) (Escherichia coli BW25113)
MIKEWATVVSWQNGQALVSCDVKASCSSCASRAGCGSRVLNKLGPQTTHTIVVPCDEPLV
PGQKVELGIAEGSLLSSALLVYMSPLVGLFLIASLFQLLFASDVAALCGAILGGIGGFLI
ARGYSRKFAARAEWQPIILSVALPPGLVRFETSSEDASQ