Protein Info for b2565 in Escherichia coli BW25113

Name: recO
Annotation: DNA repair protein RecO (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 PF11967: RecO_N" amino acids 4 to 76 (73 residues), 74.3 bits, see alignment E=6.6e-25 TIGR00613: DNA repair protein RecO" amino acids 5 to 230 (226 residues), 127.7 bits, see alignment E=2.4e-41 PF02565: RecO_C" amino acids 84 to 226 (143 residues), 80.8 bits, see alignment E=9.8e-27

Best Hits

Swiss-Prot: 100% identical to RECO_ECOL5: DNA repair protein RecO (recO) from Escherichia coli O6:K15:H31 (strain 536 / UPEC)

KEGG orthology group: K03584, DNA repair protein RecO (recombination protein O) (inferred from 100% identity to eco:b2565)

MetaCyc: 100% identical to recombination mediator protein RecO (Escherichia coli K-12 substr. MG1655)
RXN0-2606

Predicted SEED Role

"DNA recombination and repair protein RecO" in subsystem DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0A7H3 at UniProt or InterPro

Protein Sequence (242 amino acids)

>b2565 DNA repair protein RecO (NCBI) (Escherichia coli BW25113)
MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGALQPFTPLLLRF
GGRGEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVLEYETRFSELFFDYLHCIQSL
AGVTGTPEPALRRFELALLGHLGYGVNFTHCAGSGEPVDDTMTYRYREEKGFIASVVIDN
KTFTGRQLKALNAREFPDADTLRAAKRFTRMALKPYLGGKPLKSRELFRQFMPKRTVKTH
YE