Protein Info for b2558 in Escherichia coli BW25113

Name: mltF
Annotation: predicted periplasmic binding protein/transglycosylase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF00497: SBP_bac_3" amino acids 49 to 268 (220 residues), 73.4 bits, see alignment E=1.6e-24 PF01464: SLT" amino acids 297 to 402 (106 residues), 80.5 bits, see alignment E=7.2e-27

Best Hits

Swiss-Prot: 100% identical to MLTF_ECOHS: Membrane-bound lytic murein transglycosylase F (mltF) from Escherichia coli O9:H4 (strain HS)

KEGG orthology group: None (inferred from 100% identity to eco:b2558)

MetaCyc: 100% identical to membrane-bound lytic murein transglycosylase F (Escherichia coli K-12 substr. MG1655)
4.2.2.f [EC: 4.2.2.f]

Predicted SEED Role

"Transglycosylase, Slt family"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.2.f

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AGC5 at UniProt or InterPro

Protein Sequence (518 amino acids)

>b2558 predicted periplasmic binding protein/transglycosylase (RefSeq) (Escherichia coli BW25113)
MKKLKINYLFIGILALLLAVALWPSIPWFGKADNRIAAIQARGELRVSTIHTPLTYNEIN
GKPFGLDYELAKQFADYLGVKLKVTVRQNISQLFDDLDNGNADLLAAGLVYNSERVKNYQ
PGPTYYSVSQQLVYKVGQYRPRTLGNLTAEQLTVAPGHVVVNDLQTLKETKFPELSWKVD
DKKGSAELMEDVIEGKLDYTIADSVAISLFQRVHPELAVALDITDEQPVTWFSPLDGDNT
LSAALLDFFNEMNEDGTLARIEEKYLGHGDDFDYVDTRTFLRAVDAVLPQLKPLFEKYAE
EIDWRLLAAIAYQESHWDAQATSPTGVRGMMMLTKNTAQSLGITDRTDAEQSISGGVRYL
QDMMSKVPESVPENERIWFALAAYNMGYAHMLDARALTAKTKGNPDSWADVKQRLPLLSQ
KPYYSKLTYGYARGHEAYAYVENIRKYQISLVGYLQEKEKQATEAAMQLAQDYPAVSPTE
LGKEKFPFLSFLSQSSSNYLTHSPSLLFSRKGSEEKQN