Protein Info for b2543 in Escherichia coli BW25113

Name: yphA
Annotation: predicted inner membrane protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 119 to 137 (19 residues), see Phobius details PF02077: SURF4" amino acids 15 to 139 (125 residues), 30.7 bits, see alignment E=2.5e-11 PF07681: DoxX" amino acids 16 to 98 (83 residues), 74.5 bits, see alignment E=8.7e-25

Best Hits

Swiss-Prot: 100% identical to YPHA_SHIFL: Inner membrane protein YphA (yphA) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to eco:b2543)

Predicted SEED Role

"Inner membrane protein YphA" in subsystem Unknown sugar utilization (cluster yphABCDEFG)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AD47 at UniProt or InterPro

Protein Sequence (140 amino acids)

>b2543 predicted inner membrane protein (RefSeq) (Escherichia coli BW25113)
MNTLRYFDFGAARPVLLLIARIAVVLIFIIFGFPKMMGFDGTVQYMASLGAPMPMLAAII
AVVMEVPAAILIVLGFFTRPLAVLFIFYTLGTAVIGHHYWDMTGDAVGPNMINFWKNVSI
AGAFLLLAITGPGAISLDRR