Protein Info for b2540 in Escherichia coli BW25113

Name: hcaC
Annotation: 3-phenylpropionate dioxygenase, predicted ferredoxin subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00355: Rieske
  • amino acids 4 to 89 (86 residues), 68.7 bits, E=3.4e-23
• PF13806: Rieske_2
  • amino acids 7 to 99 (93 residues), 44.2 bits, E=1.6e-15

Best Hits

Swiss-Prot: 100% identical to HCAC_SHIFL: 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin subunit (hcaC) from Shigella flexneri

KEGG orthology group: K05710, ferredoxin subunit of phenylpropionate dioxygenase (inferred from 100% identity to eco:b2540)

MetaCyc: 100% identical to putative 3-phenylpropionate/cinnamate dioxygenase ferredoxin subunit (Escherichia coli K-12 substr. MG1655)
3-phenylpropanoate dioxygenase. [EC: 1.14.12.19]; 1.14.12.19 [EC: 1.14.12.19]

Predicted SEED Role

"3-phenylpropionate dioxygenase ferredoxin subunit" in subsystem Cinnamic Acid Degradation or Phenylpropionate Degradation

MetaCyc Pathways

• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (8/8 steps found)
• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation to 2-hydroxypentadienoate (5/5 steps found)
• cinnamate and 3-hydroxycinnamate degradation to 2-hydroxypentadienoate (5/5 steps found)

KEGG Metabolic Maps

• Phenylalanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.19

Use Curated BLAST to search for 1.14.12.19

Sequence Analysis Tools

See P0ABW0 at UniProt or InterPro

Protein Sequence (106 amino acids)

>b2540 3-phenylpropionate dioxygenase, predicted ferredoxin subunit (NCBI) (Escherichia coli BW25113)
MNRIYACPVADVPEGEALRIDTSPVIALFNVGGEFYAINDRCSHGNASMSEGYLEDDATV
ECPLHAASFCLKTGKALCLPATDPLTTYPVHVEGGDIFIDLPEAQP