Protein Info for b2537 in Escherichia coli BW25113

Name: hcaR
Annotation: DNA-binding transcriptional activator of 3-phenylpropionic acid catabolism (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 221 to 241 (21 residues), see Phobius details amino acids 253 to 271 (19 residues), see Phobius details PF00126: HTH_1" amino acids 3 to 62 (60 residues), 84.2 bits, see alignment E=4.8e-28 PF03466: LysR_substrate" amino acids 88 to 291 (204 residues), 159.8 bits, see alignment E=6.2e-51

Best Hits

Swiss-Prot: 100% identical to HCAR_ECOLI: Hca operon transcriptional activator HcaR (hcaR) from Escherichia coli (strain K12)

KEGG orthology group: K05817, LysR family transcriptional regulator, hca operon transcriptional activator (inferred from 100% identity to eco:b2537)

Predicted SEED Role

"Hca operon (3-phenylpropionic acid catabolism) transcriptional activator HcaR" in subsystem Cinnamic Acid Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q47141 at UniProt or InterPro

Protein Sequence (296 amino acids)

>b2537 DNA-binding transcriptional activator of 3-phenylpropionic acid catabolism (NCBI) (Escherichia coli BW25113)
MELRHLRYFVAVAQALNFTRAAEKLHTSQPSLSSQIRDLENCVGVPLLVRDKRKVALTAA
GECFLQDALAILEQAENAKLRARKIVQEDRQLTIGFVPSAEVNLLPKVLPMFRLRQPDTL
IELVSLITTQQEEKIRRGELDVGLMRHPVYSPEIDYLELFDEPLVVVLPVDHPLAHEKEI
TAAQLDGVNFVSTDPVYSGSLAPIVKAWFAQENSQPNIVQVATNILVTMNLVGMGLGVTL
IPGYMNNFNTGQVVFRPIAGNVPSIALLMAWKKGEMKPALRDFIAIVQERLASVTA