Protein Info for b2532 in Escherichia coli BW25113

Name: yfhQ
Annotation: predicted methyltransferase (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 TIGR00050: RNA methyltransferase, TrmH family, group 1" amino acids 1 to 241 (241 residues), 322.9 bits, see alignment E=7.1e-101 PF00588: SpoU_methylase" amino acids 5 to 154 (150 residues), 97.6 bits, see alignment E=3.7e-32

Best Hits

Swiss-Prot: 100% identical to TRMJ_ECOL6: tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ (trmJ) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02533, tRNA/rRNA methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to eco:b2532)

MetaCyc: 100% identical to tRNA Cm32/Um32 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11866 [EC: 2.1.1.200, 2.1.1.205]; 2.1.1.200 [EC: 2.1.1.200, 2.1.1.205]

Predicted SEED Role

"tRNA:Cm32/Um32 methyltransferase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.200 or 2.1.1.205

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0AE01 at UniProt or InterPro

Protein Sequence (246 amino acids)

>b2532 predicted methyltransferase (NCBI) (Escherichia coli BW25113)
MLQNIRIVLVETSHTGNMGSVARAMKTMGLTNLWLVNPLVKPDSQAIALAAGASDVIGNA
HIVDTLDEALAGCSLVVGTSARSRTLPWPMLDPRECGLKSVAEAANTPVALVFGRERVGL
TNEELQKCHYHVAIAANPEYSSLNLAMAVQVIAYEVRMAWLATQENGEQVEHEETPYPLV
DDLERFYGHLEQTLLATGFIRENHPGQVMNKLRRLFTRARPESQELNILRGILASIEQQN
KGNKAE