Protein Info for b2509 in Escherichia coli BW25113

Name: xseA
Annotation: exodeoxyribonuclease VII large subunit (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 PF13742: tRNA_anti_2" amino acids 10 to 103 (94 residues), 116.3 bits, see alignment E=9.2e-38 TIGR00237: exodeoxyribonuclease VII, large subunit" amino acids 11 to 359 (349 residues), 472.6 bits, see alignment E=5.4e-146 PF01336: tRNA_anti-codon" amino acids 30 to 104 (75 residues), 50.5 bits, see alignment E=2.4e-17 PF02601: Exonuc_VII_L" amino acids 126 to 440 (315 residues), 391.3 bits, see alignment E=6e-121

Best Hits

Swiss-Prot: 100% identical to EX7L_ECOLI: Exodeoxyribonuclease 7 large subunit (xseA) from Escherichia coli (strain K12)

KEGG orthology group: K03601, exodeoxyribonuclease VII large subunit [EC: 3.1.11.6] (inferred from 100% identity to eco:b2509)

MetaCyc: 100% identical to exodeoxyribonuclease VII subunit XseA (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease VII. [EC: 3.1.11.6]

Predicted SEED Role

"Exodeoxyribonuclease VII large subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P04994 at UniProt or InterPro

Protein Sequence (456 amino acids)

>b2509 exodeoxyribonuclease VII large subunit (NCBI) (Escherichia coli BW25113)
MLPSQSPAIFTVSRLNQTVRLLLEHEMGQVWISGEISNFTQPASGHWYFTLKDDTAQVRC
AMFRNSNRRVTFRPQHGQQVLVRANITLYEPRGDYQIIVESMQPAGEGLLQQKYEQLKAK
LQAEGLFDQQYKKPLPSPAHCVGVITSKTGAALHDILHVLKRRDPSLPVIIYPAAVQGDD
APGQIVRAIELANQRNECDVLIVGRGGGSLEDLWSFNDERVARAIFTSRIPVVSAVGHET
DVTIADFVADLRAPTPSAAAEVVSRNQQELLRQVQSTRQRLEMAMDYYLANRTRRFTQIH
HRLQQQHPQLRLARQQTMLERLQKRMSFALENQLKRTGQQQQRLTQRLNQQNPQPKIHRA
QTRIQQLEYRLAETLRAQLSATRERFGNAVTHLEAVSPLSTLARGYSVTTATDGNVLKKV
KQVKAGEMLTTRLEDGWIESEVKNIQPVKKSRKKVH