Protein Info for b2505 in Escherichia coli BW25113

Name: yfgH
Annotation: predicted outer membrane lipoprotein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF05433: Rick_17kDa_Anti" amino acids 73 to 114 (42 residues), 32.6 bits, see alignment E=3e-12

Best Hits

Swiss-Prot: 100% identical to YFGH_ECO57: Uncharacterized lipoprotein YfgH (yfgH) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b2505)

Predicted SEED Role

"Putative outer membrane lipoprotein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P65290 at UniProt or InterPro

Protein Sequence (172 amino acids)

>b2505 predicted outer membrane lipoprotein (NCBI) (Escherichia coli BW25113)
MMKFKKCLLPVAMLASFTLAGCQSNADDHAADVYQTDQLNTKQETKTVNIISILPAKVAV
DNSQNKRNAQAFGALIGAVAGGVIGHNVGSGSNSGTTAGAVGGGAVGAAAGSMVNDKTLV
EGVSLTYKEGTKVYTSTQVGKECQFTTGLAVVITTTYNETRIQPNTKCPEKS