Protein Info for b2504 in Escherichia coli BW25113

Name: yfgG
Updated annotation (from data): Negative regulator of nickel and cobalt uptake (YfgG)
Rationale: YfgG is important for resisting cobalt and nickel stress, as is its ortholog in Klebsiella (BWI76_RS21010). Furthermore, overexpression of yfgG confers increased resistance to cobalt (PMID:30659179). YfgG has strong negative cofitness with the Mg/Ni/Co transporter corA, as does its ortholog in Klebsiella. YfgG is a small putative membrane protein and might bind corA to inhibit it or reduce its abundance (by analogy to the magnesium transporter MtgE and the small membrane protein MtgS that binds and stabilizes MtgS.)
Original annotation: hypothetical protein (NCBI)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF11119: DUF2633
  • amino acids 7 to 49 (43 residues), 97.9 bits, E=1.1e-32

Best Hits

Swiss-Prot: 100% identical to YFGG_SHIFL: Uncharacterized protein YfgG (yfgG) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to eco:b2504)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

See P64545 at UniProt or InterPro

Protein Sequence (63 amino acids)

>b2504 Negative regulator of nickel and cobalt uptake (YfgG) (Escherichia coli BW25113)
MSQATSMRKRHRFNSRMTRIVLLISFIFFFGRFIYSSVGAWQHHQSKKEAQQSTLSVESP
VQR